PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g080670.1
Common NameMTR_8g080670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 413aa    MW: 45977.3 Da    PI: 8.0282
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g080670.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP116.71.2e-36162237277
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      CqvegC  dls+ak+y+r+ +vC  hsk+p+v+++gle+rfCqqCsrfh+l efD +k+sCrrrL++hn+rrr ++
  Medtr8g080670.1 162 CQVEGCGLDLSSAKHYYRKRRVCVDHSKSPMVVIDGLERRFCQQCSRFHDLFEFDGKKKSCRRRLSQHNARRRNHS 237
                      *************************************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-30157223IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.316159236IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-34160239IPR004333Transcription factor, SBP-box
PfamPF031108.5E-30162235IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MDLNAKSPSS QWEWDHLPLP DTKATENKKL QPPNWSIKLD RENNVWLFDT PTGSGYSGSE  60
LIPGSTSGSS KSDSISSSPT RDISKTCKFA FESSHDDSNG KIELPKEGPI EASNAPMLSC  120
VSSEPLLNLK LGKRMKFEDV SSLVFGRKCK SNDQNLQCPP LCQVEGCGLD LSSAKHYYRK  180
RRVCVDHSKS PMVVIDGLER RFCQQCSRFH DLFEFDGKKK SCRRRLSQHN ARRRNHSRKT  240
AQSSQSALSS SPCDGKQQMN PFAYSKTAIN LALQNIQNSE FPRIKDFPLK YAKVNIGTPS  300
FVTMLSDDSD VHFTSKVLET KSINAGVEDF ISFSDTDATE DFTCASSLLS TSPWDSYATK  360
SVSLVHSDRT TSTAQAITHT TSQRIPLTSS EYWHGDLDQH VDSSMWISNS RL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-231612341083squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013446576.10.0squamosa promoter-binding-like protein
TrEMBLA0A072TUS30.0A0A072TUS3_MEDTR; Squamosa promoter-binding-like protein
STRINGGLYMA18G00903.11e-108(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46303058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27360.45e-40squamosa promoter-like 11
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]